Rabbit Polyclonal MCSF Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal MCSF Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
CSF1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CSF1 |
Anti-Murine M-CSF Goat Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Murine |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Murine M-CSF |
Rabbit Polyclonal Anti-CSF1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP |
Rabbit Polyclonal Anti-CSF1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: SGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG |
Rabbit Polyclonal Anti-CSF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the N terminal of human CSF1. Synthetic peptide located within the following region: PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME |
CSF1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CSF1 |
CSF1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 33-190 of human CSF1 (NP_757351.1). |
Modifications | Unmodified |