Antibodies

View as table Download

Rabbit Polyclonal Anti-FOLR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOLR1 antibody: synthetic peptide directed towards the middle region of human FOLR1. Synthetic peptide located within the following region: HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF

Rabbit polyclonal FOLR1 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FOLR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-68 amino acids from the N-terminal region of human FOLR1.

Rabbit polyclonal anti-FOLR1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FOLR1.

Rabbit polyclonal Aggrecan (Cleaved-Asp369) antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Aggrecan.

Folate Binding Protein(FBP) / FOLR1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-93 of human Folate Binding Protein(FBP) / FOLR1 (NP_000793.1).
Modifications Unmodified

FOLR1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Human recombinant protein fragment of human FOLR1 ( NP_057937 ) produced in HEK293T.

FOLR1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Human recombinant protein fragment of human FOLR1 ( NP_057937 ) produced in HEK293T.