Antibodies

View as table Download

Rabbit Polyclonal LPIN1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LPIN1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human LPIN1.

Rabbit Polyclonal Antibody against LPIN1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide to an internal region (within residues 300-400) of the human LPIN1 protein. [Swiss-Prot# Q14693]

Rabbit Polyclonal Anti-LPIN1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LPIN1 Antibody: synthetic peptide directed towards the N terminal of human LPIN1. Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK

Rabbit Polyclonal Antibody against LPIN1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide to an internal region (within residues 500-600) of the human LPIN1 protein. [Swiss-Prot# Q14693]

LPIN1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human LPIN1

Lipin 1 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 741-890 of human Lipin 1 (NP_663731.1).
Modifications Unmodified

Lipin 1 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human Lipin 1