Antibodies

View as table Download

Rabbit Polyclonal Anti-MBP(myelin basic protein) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MBP(myelin basic protein) Antibody: Peptide sequence around aa.291~295(G-G-R-D-S

Rabbit Polyclonal Anti-MBP Antibody

Applications IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-MBP Antibody: synthetic peptide directed towards the middle region of human MBP. Synthetic peptide located within the following region: FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV

Myelin Basic Protein (MBP) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of the human MBP

MBP Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MBP

Anti-MBP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.291~295(G-G-R-D-S)derived from Human MBP

Rabbit Polyclonal Anti-MBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MBP Antibody: synthetic peptide directed towards the middle region of human MBP. Synthetic peptide located within the following region: FKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMD

MBP rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MBP