Rabbit Polyclonal Anti-RBM9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM9 antibody: synthetic peptide directed towards the middle region of human RBM9. Synthetic peptide located within the following region: TAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAP |
Rabbit Polyclonal Anti-RBM9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM9 antibody: synthetic peptide directed towards the middle region of human RBM9. Synthetic peptide located within the following region: PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT |
Rabbit Polyclonal Anti-RBM9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM9 antibody: synthetic peptide directed towards the N terminal of human RBM9. Synthetic peptide located within the following region: STQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRL |
Rabbit Polyclonal Anti-RBM9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM9 antibody: synthetic peptide directed towards the N terminal of human RBM9. Synthetic peptide located within the following region: GSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKR |
Rabbit polyclonal anti-Rbfox2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rbfox2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Rbfox2. Synthetic peptide located within the following region: PVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQE |
Rabbit Polyclonal Anti-Rbm9 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rbm9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYR |
Germany
Japan
United Kingdom
China
