Rabbit Polyclonal SIK1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Immunogen | SIK1 antibody was raised against an 18 amino acid synthetic peptide near the center of human SIK1. |
Rabbit Polyclonal SIK1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Immunogen | SIK1 antibody was raised against an 18 amino acid synthetic peptide near the center of human SIK1. |
Rabbit polyclonal SIK (Ab-182) antibody
Applications | WB |
Reactivities | Human, Rat |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human SIK around the phosphorylation site of threonine 182 (L-S-TP-W-C). |
Rabbit Polyclonal Anti-SNF1LK Antibody
Applications | IHC, WB |
Reactivities | Human |
Immunogen | The immunogen for anti-SNF1LK antibody: synthetic peptide directed towards the N terminal of human SNF1LK. Synthetic peptide located within the following region: MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK |
Rabbit Polyclonal Anti-SIK1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SIK1 |
SIK1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SIK1 (NP_775490.2). |
Modifications | Unmodified |