Snf1lk (SIK1) Rabbit Polyclonal Antibody

CAT#: TA338957

Rabbit Polyclonal Anti-SNF1LK Antibody

Product Images

WB Suggested Anti-SNF1LK Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human Stomach

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SNF1LK antibody: synthetic peptide directed towards the N terminal of human SNF1LK. Synthetic peptide located within the following region: MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 85 kDa
• Gene Name: salt inducible kinase 1
• Database Link:
  NP_775490
  Entrez Gene 150094 Human
• Background: SNF1LK play a transient role during the earliest stages of myocardial cell differentiation and/or primitive chamber formation and may also be important for the earliest stages of skeletal muscle growth and/or differentiation. It also plays a potential role in G2/M cell cycle regulation. It inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3.
• Synonyms: MSK; SIK; SNF1LK
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Mouse: 93%; Rabbit: 90%; Guinea pig: 85%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase