Antibodies

Jump to Filters
View as table Download
UBN1 (1-190) Mouse Monoclonal Antibody [Clone ID: UBN1-02]
AM26039PU-N

USD 270.00

2 Weeks

UBN1 (1-190) mouse monoclonal antibody, clone UBN1-02, Aff - Purified

Applications IP, WB
Reactivities Human
UBN1 Rabbit Polyclonal Antibody
TA342459

USD 375.00

5 Days

Rabbit Polyclonal Anti-UBN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBN1 antibody: synthetic peptide directed towards the C terminal of human UBN1. Synthetic peptide located within the following region: NGDSSGGTQGVAKLLTSPSLKPSAVSSVTSSTSLSKGASGTVLLAGSSLM