Antibodies

View as table Download

Rabbit anti-HLA-DPB1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human HLA-DPB1

Rabbit anti-PRG2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRG2

Anti-HLA-DRA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha

Rabbit polyclonal anti-CD40 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human CD40.

Rabbit Polyclonal Anti-EPX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPX antibody: synthetic peptide directed towards the middle region of human EPX. Synthetic peptide located within the following region: LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDP

HLA-DRA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HLA-DRA

Anti-Human IL-5 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-5

Rabbit Polyclonal Anti-Interleukin 4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 4 Antibody: A synthesized peptide derived from human Interleukin 4

USD 320.00

In Stock

Goat Polyclonal Anti-IL10 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human IL10 produced in E. coli.

Rabbit polyclonal anti-HLA-DOB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HLA-DOB.

Rabbit polyclonal anti-IL-3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-3 antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-3 protein.

Rabbit Polyclonal IL-9 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-9 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human IL-9.

HLA-DRB3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human HLA-DRB3

Rabbit anti-FCER1A Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human FCER1A

Anti-Human IL-4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-4

Anti-Human IL-10 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-10

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN

Rabbit Polyclonal Anti-CD40 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD

Rabbit Polyclonal Anti-CD40 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV

Rabbit Polyclonal Anti-Interleukin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5
TNF

USD 320.00

In Stock

Goat Polyclonal Anti-TNF alpha Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human TNF-_ produced in E. coli.

Rabbit polyclonal antibody to HLA-DMB (major histocompatibility complex, class II, DM beta)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 199 and 263 of HLA-DMB (Uniprot ID#P28068)

Rabbit polyclonal anti-IL4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human IL4.

Rabbit polyclonal anti-HLA-DOA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HLA-DOA.

Rabbit polyclonal anti-HA2Q antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HA2Q.

Rabbit polyclonal IL4 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4.

Anti-Human IL-9 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-9

Anti-Human IL-13 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-13

TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Eotaxin Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Eotaxin antibody was raised in rabbits against a peptide corresponding to amino acids near the carboxy terminus of human eotaxin.

Rabbit polyclonal anti-IL-4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human IL-4

Rabbit polyclonal TNF Alpha antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Rabbit polyclonal TNF alpha antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Anti-Human IL-3 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-3

Rabbit polyclonal antibody to HLA-DRB1 (major histocompatibility complex, class II, DR beta 1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 56 and 250 of HLA-DRB1 (Uniprot ID#P01912)

Rabbit polyclonal antibody to HLA-DRB4 (major histocompatibility complex, class II, DR beta 4)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 266 of HLA DR beta (Uniprot ID#P13762)

Goat Anti-HLA-DQA2 & HLA-DQA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QGLRSVGASRH, from the C Terminus of the protein sequence according to NP_064440.1; NP_002113.2.

Rabbit polyclonal anti-CD40 antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues surrounding amino acids 261 of human CD40

Rabbit polyclonal anti-IL-3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human IL-3

Rabbit polyclonal anti-IL-4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.

Rabbit polyclonal IL-4 antibody Peroxidase Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.

Rabbit polyclonal IL-4 antibody Biotin Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.

Rabbit polyclonal anti-IL-10 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with human IL-10.

Rabbit polyclonal anti-IL-9 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein.

Rabbit polyclonal IL-9 antibody Peroxidase Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein.

Anti-FCER1A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 26-205 amino acids of human Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide

Rabbit polyclonal HLA-DQB1 Antibody (N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HLA-DQB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-39 amino acids from the N-terminal region of human HLA-DQB1.

Rabbit polyclonal Anti-HLA-DQA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the N terminal of human HLA-DQA2. Synthetic peptide located within the following region: GVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQS

Rabbit polyclonal Anti-HLA-DQA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the middle region of human HLA-DQA2. Synthetic peptide located within the following region: LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK

Goat Anti-FCER1A (aa177-189) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TGKVWQLDYESEP, from the internal region of the protein sequence according to NP_001992.1.