Antibodies

View as table Download

Rabbit anti-PDGFB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PDGFB

Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD

PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human PDGF-BB.

PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) Recombinant Human PDGF-B.

PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) Recombinant Human PDGF-B.

PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human PDGF-BB.

Rabbit polyclonal anti-PDGFB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PDGFB.

Rabbit Polyclonal PDGF-B Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal PDGF-B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PDGF-B.

Rabbit polyclonal anti-PDGF-BB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed human PDGF-BB

Rabbit polyclonal anti-PDGF-BB antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen E. coli expressed murine PDGF-BB

Rabbit Polyclonal PDGFB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human PDGFB.