TYK2 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
TYK2 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TYK2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TYK2 Antibody: A synthesized peptide derived from human TYK2 |
Rabbit polyclonal antibody to TYK2 (tyrosine kinase 2)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 680 and 1187 of TYK2 (Uniprot ID#P29597) |
Rabbit anti-TYK2 (Phospho-Tyr1054) polyclonal antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanTYK2 around the phosphorylation site of tyrosine 1054 (H-E-YP-Y-R). |
Modifications | Phospho-specific |
Anti-TYK2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human tyrosine kinase 2 |
Rabbit Polyclonal TYK2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal TYK2 antibody was raised against a 17 amino acid peptide near the amino terminus of human TYK2. |
Rabbit Polyclonal anti-TYK2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TYK2 antibody: synthetic peptide directed towards the C terminal of human TYK2. Synthetic peptide located within the following region: HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAP |
Phospho-TYK2-Y1054 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y1054 of human TYK2 |
Modifications | Phospho-specific |
TYK2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TYK2 |
TYK2 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 750-850 of human TYK2 (NP_003322.3). |
Modifications | Unmodified |
Phospho-Tyk2-Y1054/1055 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around Y1054 & Y1055 of human Tyk2 (NP_003322.3). |
Modifications | Phospho Y1054/1055 |
Phospho-Tyk2-Y292 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around Y292 of human Tyk2 (NP_003322.3). |
Modifications | Phospho Y292 |