Rabbit polyclonal C1R (heavy chain, Cleaved-Arg463) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human C1R heavy chain. |
Rabbit polyclonal C1R (heavy chain, Cleaved-Arg463) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human C1R heavy chain. |
Rabbit polyclonal C1R (light chain, Cleaved-Ile464) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human C1R. |
Rabbit Polyclonal Anti-C1R Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C1R antibody is: synthetic peptide directed towards the middle region of Human C1R. Synthetic peptide located within the following region: VDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQ |
Carrier-free (BSA/glycerol-free) C1R mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C1R mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
C1R rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human C1R |
C1R Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 466-705 of human C1R (NP_001724.3). |
Modifications | Unmodified |
C1R Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 466-705 of human C1R (NP_001724.3). |
Modifications | Unmodified |
C1R mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
C1R mouse monoclonal antibody,clone 5A11, Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
C1R mouse monoclonal antibody,clone 5A11, HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
C1R mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
C1R mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
C1R mouse monoclonal antibody,clone 1F1, Biotinylated
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Biotin |
C1R mouse monoclonal antibody,clone 1F1, HRP conjugated
Applications | WB |
Reactivities | Human, Dog |
Conjugation | HRP |
C1R mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |