Rabbit Polyclonal Anti-C1orf103 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C1orf103 Antibody: synthetic peptide directed towards the middle region of human C1orf103. Synthetic peptide located within the following region: SHSKTRQEKRTEMEYYTHEKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVT |
Rabbit Polyclonal Anti-C1orf103 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C1orf103 Antibody: synthetic peptide directed towards the N terminal of human C1orf103. Synthetic peptide located within the following region: KKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGE |
LRIF1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human C1ORF103 |
LRIF1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human C1ORF103 |
Germany
Japan
United Kingdom
China
