Antibodies

View as table Download

Rabbit Polyclonal Anti-MAGEA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAGEA4 antibody: synthetic peptide directed towards the C terminal of human MAGEA4. Synthetic peptide located within the following region: ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP

Carrier-free (BSA/glycerol-free) MAGEA4 mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAGEA4 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAGEA4 mouse monoclonal antibody, clone OTI5E8 (formerly 5E8)

Applications WB
Reactivities Human
Conjugation Unconjugated

MAGEA4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 28-317 of human MAGEA4 (NP_002353.3).
Modifications Unmodified

MAGEA4 mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

MAGEA4 mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

MAGEA4 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

MAGEA4 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

MAGEA4 mouse monoclonal antibody, clone OTI5E8 (formerly 5E8)

Applications WB
Reactivities Human
Conjugation Unconjugated

MAGEA4 mouse monoclonal antibody, clone OTI5E8 (formerly 5E8)

Applications WB
Reactivities Human
Conjugation Unconjugated