Antibodies

View as table Download

Rabbit Polyclonal Anti-MBP(myelin basic protein) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MBP(myelin basic protein) Antibody: Peptide sequence around aa.291~295(G-G-R-D-S

Mouse Monoclonal MBP Antibody (2H9)

Applications ELISA, FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
TA336919 is a replacement of AM06698SU-N.

Rabbit Polyclonal Anti-MBP Antibody

Applications IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-MBP Antibody: synthetic peptide directed towards the middle region of human MBP. Synthetic peptide located within the following region: FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV

Chicken Anti-Myelin Basic Protein (MBP) Antibody

Applications IF, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Three peptide sequences conserved in higher vertebrate MBP proteins

MBP Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MBP

Rabbit Polyclonal MBP Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Reacts with residues 49-62 of Isoforms 5 and 6 of the human protein. The immunogen corresponds to Isoform 1 between amino acids 182-195 of the 33 kDa isoform. The antibody also detects mouse and rat MBP protein. The antibody primarily detects a 22 kDa ban

Anti-MBP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.291~295(G-G-R-D-S)derived from Human MBP

Rabbit Polyclonal Anti-MBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MBP Antibody: synthetic peptide directed towards the middle region of human MBP. Synthetic peptide located within the following region: FKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMD

MBP rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MBP