Antibodies

View as table Download

Rabbit Polyclonal Anti-TYK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TYK2 Antibody: A synthesized peptide derived from human TYK2

Rabbit polyclonal antibody to TYK2 (tyrosine kinase 2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 680 and 1187 of TYK2 (Uniprot ID#P29597)

Rabbit anti-TYK2 (Phospho-Tyr1054) polyclonal antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized phosphopeptide derived from humanTYK2 around the phosphorylation site of tyrosine 1054 (H-E-YP-Y-R).
Modifications Phospho-specific

Anti-TYK2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human tyrosine kinase 2

Rabbit Polyclonal TYK2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal TYK2 antibody was raised against a 17 amino acid peptide near the amino terminus of human TYK2.

Rabbit Polyclonal anti-TYK2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TYK2 antibody: synthetic peptide directed towards the C terminal of human TYK2. Synthetic peptide located within the following region: HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAP

Phospho-TYK2-Y1054 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y1054 of human TYK2
Modifications Phospho-specific

TYK2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TYK2

TYK2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 750-850 of human TYK2 (NP_003322.3).
Modifications Unmodified

Phospho-Tyk2-Y1054/1055 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around Y1054 & Y1055 of human Tyk2 (NP_003322.3).
Modifications Phospho Y1054/1055

Phospho-Tyk2-Y292 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around Y292 of human Tyk2 (NP_003322.3).
Modifications Phospho Y292