Antibodies

Jump to Filters
View as table Download
Zinc Alpha 2 Glycoprotein (AZGP1) Rabbit Polyclonal Antibody
TA332643

USD 275.00

3 Weeks

Rabbit anti-AZGP1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human AZGP1
Zinc Alpha 2 Glycoprotein (AZGP1) Rabbit Polyclonal Antibody
TA344276

USD 475.00

5 Days

Rabbit Polyclonal Anti-AZGP1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AZGP1 antibody: synthetic peptide directed towards the N terminal of human AZGP1. Synthetic peptide located within the following region: MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL
Zinc Alpha 2 Glycoprotein (AZGP1) (N-term) Rabbit Polyclonal Antibody
AP17144PU-N

USD 450.00

2 Weeks

Zinc Alpha 2 Glycoprotein (AZGP1) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human AZGP1
Zinc Alpha 2 Glycoprotein (AZGP1) Mouse Monoclonal Antibody [Clone ID: OTI10F2]
CF812185

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) AZGP1 mouse monoclonal antibody,clone OTI10F2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Zinc Alpha 2 Glycoprotein (AZGP1) Mouse Monoclonal Antibody [Clone ID: OTI2H3]
CF812186

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) AZGP1 mouse monoclonal antibody,clone OTI2H3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Zinc Alpha 2 Glycoprotein (AZGP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10F2]
TA812185AM

USD 420.00

4 Weeks

AZGP1 mouse monoclonal antibody,clone OTI10F2, Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
Zinc Alpha 2 Glycoprotein (AZGP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10F2]
TA812185BM

USD 420.00

4 Weeks

AZGP1 mouse monoclonal antibody,clone OTI10F2, HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP
Zinc Alpha 2 Glycoprotein (AZGP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H3]
TA812186AM

USD 420.00

4 Weeks

AZGP1 mouse monoclonal antibody,clone OTI2H3, Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
Zinc Alpha 2 Glycoprotein (AZGP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H3]
TA812186BM

USD 420.00

4 Weeks

AZGP1 mouse monoclonal antibody,clone OTI2H3, HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP