Antibodies

View as table Download

CELA1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Porcine
Immunogen Elastase isolated and purified from Porcine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure.

CELA1 mouse monoclonal antibody, clone 4H5, Purified

Applications ELISA, IHC, WB
Reactivities Human

CELA1 rabbit polyclonal antibody, Serum

Applications ELISA, WB
Reactivities Porcine
Immunogen Elastase from Porcine pancreas.

CELA1 rabbit polyclonal antibody, Biotin, Purified

Applications ELISA, WB
Reactivities Porcine
Conjugation Biotin
Immunogen Elastase from porcine pancreas

CELA1 rabbit polyclonal antibody, HRP, Purified

Applications ELISA, WB
Reactivities Porcine
Conjugation HRP
Immunogen Elastase from porcine pancreas

CELA1 rabbit polyclonal antibody, Purified

Applications ELISA, WB
Reactivities Porcine
Immunogen Elastase from porcine pancreas

Rabbit Polyclonal Anti-ELA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELA1 antibody: synthetic peptide directed towards the N terminal of human ELA1. Synthetic peptide located within the following region: LVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGT

Rabbit Polyclonal Anti-Ela1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ela1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAGYDIALLRLAKSV