Antibodies

View as table Download

Rabbit Polyclonal Anti-MPRIP Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Mprip antibody is: synthetic peptide directed towards the middle region of Rat Mprip. Synthetic peptide located within the following region: ATISAIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQYLEELQSV

Rabbit polyclonal anti-MRIP antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MRIP.

MPRIP Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MPRIP

MPRIP Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-310 of human MPRIP (NP_055949.2).
Modifications Unmodified