PDPN rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PDPN |
PDPN rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PDPN |
Golden Syrian Hamster Monoclonal Podoplanin Antibody (8.1.1)
Applications | FC, IHC, WB |
Reactivities | Mouse (Does not react with: Human) |
Conjugation | Unconjugated |
Goat Anti-PDPN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EKVDGDTQTTVEKD, from the internal region of the protein sequence according to NP_006465.3; NP_938203.2; NP_001006625.1; NP_001006626.1. |
Rabbit Polyclonal Anti-PDPN Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PDPN Antibody: synthetic peptide directed towards the N terminal of human PDPN. Synthetic peptide located within the following region: EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT |
Rabbit Polyclonal Anti-PDPN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PDPN Antibody: synthetic peptide directed towards the middle region of human PDPN. Synthetic peptide located within the following region: VATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVM |
Carrier-free (BSA/glycerol-free) PDPN mouse monoclonal antibody,clone OTI3H5
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDPN mouse monoclonal antibody,clone OTI7B4
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PDPN Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PDPN |
Podoplanin Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Podoplanin |
Modifications | Unmodified |
Podoplanin Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Podoplanin |
Podoplanin Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Podoplanin |
PDPN mouse monoclonal antibody,clone OTI3H5
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PDPN mouse monoclonal antibody,clone OTI3H5, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
PDPN mouse monoclonal antibody,clone OTI3H5, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
PDPN mouse monoclonal antibody,clone OTI3H5
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PDPN mouse monoclonal antibody,clone OTI7B4
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PDPN mouse monoclonal antibody,clone OTI7B4, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
PDPN mouse monoclonal antibody,clone OTI7B4, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
PDPN mouse monoclonal antibody,clone OTI7B4
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |