Antibodies

Jump to Filters
View as table Download
VAMP5 Rabbit Polyclonal Antibody
TA341852

USD 310.00

5 Days

Rabbit Polyclonal Anti-VAMP5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VAMP5 antibody: synthetic peptide directed towards the middle region of human VAMP5. Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
VAMP5 Mouse Monoclonal Antibody [Clone ID: OTI7F2]
CF808605

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) VAMP5 mouse monoclonal antibody,clone OTI7F2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
VAMP5 Rabbit Polyclonal Antibody
TA350595

USD 345.00

In Stock

Rabbit Polyclonal Anti-VAMP5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein
VAMP5 Rabbit Polyclonal Antibody
TA383189

USD 220.00

3 Weeks

VAMP5 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human VAMP5 (NP_006625.1).
Modifications Unmodified
VAMP5 Mouse Monoclonal Antibody [Clone ID: OTI7F2]
TA808605

USD 379.00

In Stock

VAMP5 mouse monoclonal antibody,clone OTI7F2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
VAMP5 Mouse Monoclonal Antibody [Clone ID: OTI7F2]
TA808605S

USD 159.00

2 Days

VAMP5 mouse monoclonal antibody,clone OTI7F2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated