Apolipoprotein B (APOB) goat polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
Immunogen | ApoLipoprotein Type B was isolated from human plasma by density gradient centrifugation followed by HPLC purification, |
Apolipoprotein B (APOB) goat polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
Immunogen | ApoLipoprotein Type B was isolated from human plasma by density gradient centrifugation followed by HPLC purification, |
Rabbit Polyclonal Anti-APOB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APOB antibody: synthetic peptide directed towards the middle region of human APOB. Synthetic peptide located within the following region: SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV |
Apolipoprotein B (APOB) goat polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Affinity purified Apolipoprotein-B (hLDL) |
Goat Anti-APOB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TDLHLRYQKDKK, from the internal region of the protein sequence according to NP_000375.2. |
ApoB Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 28-330 of human ApoB (NP_000375.2). |
Modifications | Unmodified |