Antibodies

Jump to Filters
View as table Download
CBX1 Goat Polyclonal Antibody
TA303064

USD 375.00

5 Days

Goat Polyclonal Antibody against CBX1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QSQKTAHETDKSE, from the internal region of the protein sequence according to NP_006798.1.
CBX1 Rabbit Polyclonal Antibody
TA335672

USD 375.00

5 Days

Rabbit Polyclonal Anti-CBX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CBX1 Antibody: synthetic peptide directed towards the N terminal of human CBX1. Synthetic peptide located within the following region: MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDN
CBX1 Rabbit Polyclonal Antibody
TA335673

USD 310.00

5 Days

Rabbit Polyclonal Anti-CBX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CBX1 Antibody: synthetic peptide directed towards the middle region of human CBX1. Synthetic peptide located within the following region: PDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKP
CBX1 Rabbit Polyclonal Antibody
TA374322

USD 220.00

3 Weeks

CBX1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human CBX1 (NP_006798.1).
Modifications Unmodified