KCNMB3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNMB3 |
KCNMB3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNMB3 |
Mouse monoclonal BK Beta3a Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal Anti-sloBeta3 (KCNMB3) (extracellular)
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)HYDEEAIRTNPK, corresponding to amino acid residues 134- 145 of rat SloÃ?3. Extracellular loop. |
Rabbit Polyclonal Anti-KCNMB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNMB3 antibody: synthetic peptide directed towards the middle region of human KCNMB3. Synthetic peptide located within the following region: SLTLLGGALIVGMVRLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLC |
Rabbit Polyclonal Anti-KCNMB3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNMB3 |