Rabbit polyclonal anti-MAPK3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAPK3. |
Rabbit polyclonal anti-MAPK3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAPK3. |
Rabbit Polyclonal Anti-MAPK3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAPK3 Antibody: A synthesized peptide derived from human MAPK3 |
Rabbit Polyclonal Anti-MAPKAPK3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAPKAPK3 antibody: synthetic peptide directed towards the C terminal of human MAPKAPK3. Synthetic peptide located within the following region: KEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSASQGCNN |
Rabbit Polyclonal Anti-MAPKAPK3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAPKAPK3 antibody: synthetic peptide directed towards the C terminal of human MAPKAPK3. Synthetic peptide located within the following region: PLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLN |
MAPKAPK3 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MAPKAPK3 |
MAPKAPK3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MAPKAPK3 |
MAPKAPK3 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human MAPKAPK3 (NP_004626.1). |
Modifications | Unmodified |