Antibodies

View as table Download

Rabbit polyclonal anti-MGST1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MGST1.

Microsomal Glutathione S transferase 1 (MGST1) (40-71) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human MGST1.

Rabbit Polyclonal Anti-MGST1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MGST1 antibody: synthetic peptide directed towards the N terminal of human MGST1. Synthetic peptide located within the following region: NPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSL

Microsomal Glutathione S transferase 1 (MGST1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal anti-GST Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit anti GST Polyclonal Antibody

Applications WB
Conjugation Unconjugated
Immunogen A full length of GST recombinant protein.

MGST1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MGST1 (NP_001247440.1).
Modifications Unmodified