Antibodies

View as table Download

Rabbit Polyclonal Anti-MIF4GD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MIF4GD antibody: synthetic peptide directed towards the C terminal of human MIF4GD. Synthetic peptide located within the following region: LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD

Rabbit Polyclonal Anti-MIF4GD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MIF4GD antibody: synthetic peptide directed towards the N terminal of human MIF4GD. Synthetic peptide located within the following region: MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSR

Carrier-free (BSA/glycerol-free) MIF4GD mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MIF4GD mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MIF4GD rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MIF4GD

MIF4GD mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MIF4GD mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MIF4GD mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MIF4GD mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated