Antibodies

View as table Download

OPRM1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human OPRM1

Mu Opioid Receptor (OPRM1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Porcine, Rat
Immunogen KLH conjugated synthetic peptide between 161-187 amino acids from the Center region of human OPRM1

Rabbit polyclonal anti-OPRM1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OPRM1.

Rabbit Polyclonal Anti-Oprm1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Oprm1 antibody is: synthetic peptide directed towards the middle region of Mouse Oprm1. Synthetic peptide located within the following region: CYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV

Rabbit polyclonal Anti-mu-Opioid Receptor (extracellular)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CSPAPGSWLNLSHVDGN, corresponding to amino acid residues 22-38 of the rat µ-Opioid receptor. Extracellular, N-terminus.

Rabbit Polyclonal mu Opioid R/OPMR1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide comprising residues 386-400 of the human, mouse and rat MOR-1 protein.

Anti-OPRM1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.373~377 (H-P-S-T-A) derived from Human Opioid Receptor.

Phospho-OPRM1-S375 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S375 of human OPRM1
Modifications Phospho-specific

Mu Opioid Receptor(MOR) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human Mu Opioid Receptor(MOR) (NP_000905.3).