Rabbit Polyclonal Anti-PFDN1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PFDN1 Antibody: A synthesized peptide derived from human PFDN1 |
Rabbit Polyclonal Anti-PFDN1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PFDN1 Antibody: A synthesized peptide derived from human PFDN1 |
Rabbit polyclonal anti-PFDN1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PFDN1. |
PFDN1 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Goat Anti-Prefoldin / PFDN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DNIREMLMARRAQ, from the C Terminus of the protein sequence according to NP_002613.2. |
Rabbit Polyclonal Anti-PFDN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PFDN1 Antibody: synthetic peptide directed towards the N terminal of human PFDN1. Synthetic peptide located within the following region: MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTE |
PFDN1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human PFDN1 (NP_002613.2). |
Modifications | Unmodified |