Rabbit Polyclonal Anti-SUSD3 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | SUSD3 antibody was raised against a 16 amino acid peptide from near the center of human SUSD3. The immunogen is located within amino acids 120 - 170 of SUSD3. |
Rabbit Polyclonal Anti-SUSD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SUSD3 Antibody: synthetic peptide directed towards the N terminal of human SUSD3. Synthetic peptide located within the following region: LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW |
Germany
Japan
United Kingdom
China
