TOR2A (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 201-229 amino acids from the Central region of human TOR2A |
TOR2A (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 201-229 amino acids from the Central region of human TOR2A |
Rabbit Polyclonal Anti-TOR2A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TOR2A antibody: synthetic peptide directed towards the N terminal of human TOR2A. Synthetic peptide located within the following region: GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS |