Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Goat Polyclonal Antibody against GOT1 (Internal region)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RSYRYWDAEKR, from the internal region of the protein sequence according to NP_002070.1. |
Rabbit polyclonal anti-GAD67/GAD1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GAD67. |
Modifications | Phospho-specific |
Rabbit Polyclonal antibody to ASS1 (argininosuccinate synthetase 1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 198 of ASS1 (Uniprot ID#P00966) |
Rabbit Polyclonal Anti-GPT Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPT antibody: synthetic peptide directed towards the N terminal of human GPT. Synthetic peptide located within the following region: RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT |
Rabbit Monoclonal antibody against CPS1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GLUD1 Goat Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Chimpanzee, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Pig |
Conjugation | Unconjugated |
Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against synthetic peptide C-ESEEQKRNRVRGILR from an internal region of human GLUD1 (NP_005262.1; NP_036216.2). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Panda, Horse, Pig (100%); Rat, Opossum, Pufferfish (93%); Bovine, Xenopus, Stickleback (87%). |
Rabbit Polyclonal ALDH4A1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Goat Polyclonal Antibody against Argininosuccinate synthetase 1
Applications | WB |
Reactivities | Human, Cow |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ENPKNQAPPGLYTKTQD, from the internal region of the protein sequence according to NP_000041.2 ; NP_446464.1. |
GLUD1 Rabbit anti-Bovine Polyclonal Antibody
Applications | IHC |
Reactivities | Bovine, Human |
Conjugation | Unconjugated |
Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against bovine liver glutamate dehydrogenase. |
Aspartate Aminotransferase Goat Polyclonal (aa157-167) Antibody
Applications | IHC |
Reactivities | Gibbon, Chimpanzee, Gorilla, Hamster, Human, Orang-Utan, Rat |
Conjugation | Unconjugated |
Immunogen | Aspartate Aminotransferase antibody was raised against synthetic peptide C-RSYRYWDAEKR from an internal region of human GOT1 (NP_002070.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Hamster, Elephant (100%); Marmoset, Goat, Pig, Lizard (91%); Mouse, Panda, Bat, Bovine, Horse, Opossum, Turkey, Chicken, Platypus, Xenopus, Salmon, Pufferfish, Seq squirt (82%). |
Rabbit polyclonal CAD (Thr456) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CAD around the phosphorylation site of threonine 456 (P-I-TP-P-H). |
Modifications | Phospho-specific |
Carrier-free (BSA/glycerol-free) GAD1 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PPAT mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PPAT mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PPAT mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ASL mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ASL mouse monoclonal antibody,clone OTI9G2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ASL mouse monoclonal antibody, clone OTI14C7 (formerly 14C7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI5B8 (formerly 5B8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASPA mouse monoclonal antibody, clone OTI3B5 (formerly 3B5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI6H1 (formerly 6H1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI7C4 (formerly 7C4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI6H9 (formerly 6H9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI6C9 (formerly 6C9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI7H1 (formerly 7H1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI7E9 (formerly 7E9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI4G9 (formerly 4G9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI8A3 (formerly 8A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI14C1 (formerly 14C1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody,clone OTI3D1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody,clone OTI8H4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody,clone OTI12G1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLS2 mouse monoclonal antibody,clone OTI1C12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLS2 mouse monoclonal antibody,clone OTI4C10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLS2 mouse monoclonal antibody,clone OTI6D11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CPS1 mouse monoclonal antibody, clone OTI7B6
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |