Goat Polyclonal Anti-tdTomato Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-tdTomato Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-mCherry Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Peroxidase Conjugated Affinity Purified Goat anti-Mouse IgG [H&L]
Applications | WB: 1: 1,000; ICC: 1:200; IP: 1:200 |
Reactivities | Mouse IgG |
Conjugation | HRP |
Immunogen | Mouse IgG, whole molecule |
Goat Polyclonal Anti-ZO1 Antibody
Applications | IF, IHC, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli. |
Goat Polyclonal Anti-GFP Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-mCherry Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-mCherry Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Anti-6X His tag rabbit polyclonal antibody
Applications | ELISA, IP, WB |
Immunogen | Rabbit Polyclonal antibody to 6X His tag |
Rabbit Polyclonal tdTomato Antibody
Applications | WB |
Immunogen | tdTomato |
Goat Polyclonal Anti-GFP Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-UIS4 Antibody
Applications | IF |
Reactivities | Plasmodium berghei |
Immunogen | Purified recombinant peptide produced in E. coli. |
Rabbit Polyclonal mCherry Antibody
Applications | WB |
Immunogen | mCherry |
Rabbit Polyclonal turboGFP Antibody
Applications | WB |
Immunogen | Purified tGFP protein expressed in E. coli. |
FITC Conjugated Goat Anti-Rabbit IgG
Applications | FC: 1:100; IF/ICC: 1:32-64; IHC: 1:32-64 |
Reactivities | Rabbit IgG |
Conjugation | FITC |
Immunogen | Rabbit IgG, whole molecule |
Rabbit polyclonal anti-ABCC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC3. |
Goat Polyclonal Anti-CANX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli. |
Rabbit Anti-Mouse IgG Secondary Antibody
Applications | WB, IHC, IF/ICC, ELISA |
Reactivities | Mouse IgG |
Conjugation | Unconjugated |
Immunogen | Mouse IgG, whole molecule |
Goat Polyclonal Anti-mCherry Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-RFP Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant RFP peptide produced in E. coli. |
Rabbit Polyclonal mKate Antibody
Applications | WB |
Immunogen | Purified mKate protein expressed in E. coli. |
Goat Polyclonal Anti-CD63 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli. |
Anti-DDK (FLAG) rabbit polyclonal antibody
Applications | WB |
Immunogen | Synthetic peptide (DYKDDDDK) conjugated to KLH |
Rabbit Polyclonal mGFP Antibody
Applications | WB |
Immunogen | mGFP |
Goat Polyclonal Antibody against ABCC4
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2. |
Goat Polyclonal Anti-GFP Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Rabbit Polyclonal Anti-GPA33 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GPA33 |
Goat Polyclonal Anti-GFP Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Rabbit polyclonal anti-ABCC2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC2. |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Goat Polyclonal tdTomato Antibody
Applications | WB |
Immunogen | tdTomato |
Goat Polyclonal Anti-UIS4 Antibody
Applications | ICC/IF |
Reactivities | Plasmodium berghei |
Immunogen | Purified recombinant peptide produced in E. coli. |
Biotinylated Anti-Human IL-21 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-21 |
Anti-Dendra2 rabbit polyclonal antibody
Applications | WB |
Immunogen | Purified Dendra2 protein expressed in E. coli. |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Anti-MYC tag rabbit polyclonal antibody
Applications | WB |
Immunogen | Synthetic peptide (EQKLISEEDL) conjugated to KLH |
Anti-His tag rabbit polyclonal antibody
Applications | WB |
Immunogen | Synthetic peptide (HHHHHH) conjugated to KLH |
Goat Polyclonal turboGFP Antibody
Applications | WB |
Immunogen | Purified tGFP protein expressed in E. coli. |
Rabbit Polyclonal Anti-LILRB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LILRB2 |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Rabbit anti-BRCA1 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P). |
Rabbit Polyclonal Anti-NGF Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NGF |
FITC Conjugated Goat Anti-Rabbit IgG
Applications | FC: 1:100; IF/ICC: 1:32-64; IHC: 1:32-64 |
Reactivities | Rabbit IgG |
Conjugation | FITC |
Immunogen | Rabbit IgG, whole molecule |
Goat Polyclonal mCherry Antibody
Applications | WB |
Immunogen | mCherry |
Rabbit Polyclonal eGFP Antibody
Applications | WB |
Immunogen | Purified eGFP protein expressed in E. coli. |
Goat Polyclonal Anti-CANX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli. |
Goat Polyclonal mPlum Antibody
Applications | WB |
Immunogen | Purified mPlum protein expressed in E. coli. |
Goat Polyclonal Anti-CX43 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli. |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
Rabbit Polyclonal Anti-EGFLAM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |