Rabbit polyclonal anti-ABCC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC3. |
Rabbit polyclonal anti-ABCC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC3. |
Goat Polyclonal Antibody against ABCC4
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2. |
Rabbit polyclonal anti-ABCC2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC2. |
Rabbit polyclonal antibody to ABCD2 (ATP-binding cassette, sub-family D (ALD), member 2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 338 and 588 of ABCD2 (Uniprot ID#Q9UBJ2) |
Goat Polyclonal Antibody against ABCC8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EFDKPEKLLSRKD, from the C Terminus of the protein sequence according to NP_000343.2. |
Rabbit Monoclonal antibody against PMP70
Applications | Assay, FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CFTR
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KEETEEEVQDTRL, corresponding to amino acid residues 1468-1480 of human CFTR . Cytoplasmic, C-terminal part. |
Rabbit Polyclonal Anti-Abca7 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL |
Goat Polyclonal Antibody against ABCB5
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QTQHRNTSKKAQ, from the internal region of the protein sequence according to NP_848654.3. |
Goat Polyclonal Antibody against ABCC5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KDIDIGKEYIIP-C, from the N Terminus of the protein sequence according to NP_005679.2; NP_001018881.1. |
Rabbit polyclonal anti-ABCB10 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCB10. |
Rabbit polyclonal anti-ABCD4 antibody
Applications | WB |
Reactivities | Human Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCD4. |
Rabbit polyclonal anti-ABCD1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCD1. |
Rabbit polyclonal anti-ABCA8 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCA8. |
Rabbit polyclonal anti-ABCA6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ABCA6. |
Rabbit polyclonal anti-ABCA13 antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCA13. |
Anti-ABCG1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 349-362 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 1 |
Rabbit Polyclonal ABCB5 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal ABCA8 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal ABCG2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal ABCG2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2C7 (formerly 2C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI6H2 (formerly 6H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI4F3 (formerly 4F3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI5E3 (formerly 5E3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI1F8 (formerly 1F8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI13A11 (formerly 13A11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI5B3 (formerly 5B3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2F7 (formerly 2F7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCD1 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCD1 mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCD1 mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCD1 mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCD1 mouse monoclonal antibody, clone OTI3A1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCD1 mouse monoclonal antibody, clone OTI5G6 (formerly 5G6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI8A9 (formerly 8A9)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI11D2 (formerly 11D2)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI1A7 (formerly 1A7)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI10H3 (formerly 10H3)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCC5 mouse monoclonal antibody, clone OTI5A8 (formerly 5A8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |