Rabbit Polyclonal NAD Synthetase Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal NAD Synthetase Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Anti-NADSYN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NADSYN1 antibody is: synthetic peptide directed towards the C-terminal region of Human NADSYN1. Synthetic peptide located within the following region: NQISYTPQDPRDLCGRILTTCYMASKNSSQETCTRARELAQQIGSHHISL |