Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 16 of 16 results

(reset)

Amyloid Precursor Protein (APP) Rabbit Polyclonal Antibody

TA326459

USD 400.00

2 Weeks

Rabbit Polyclonal Anti-Amyloid Oligomers (A11) Antibody

Applications	WB
Reactivities	Human, Mouse, Rat, Eukaryotes
Conjugation	Unconjugated
Immunogen	Synthetic molecular mimic of soluble oligomers.

1 / 2

2 / 2

Previous Next

NMDAR2B (GRIN2B) Rabbit Polyclonal Antibody

TA309191

USD 415.00

In Stock

Rabbit Anti-NMDA NR2B Subunit Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein from the C-terminal region of the NR2B subunit

ADAM17 Rabbit Polyclonal Antibody

TA305951

USD 430.00

2 Weeks

Rabbit Polyclonal TACE Antibody

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	TACE antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human TACE This sequence differs from those of mouse and rat TACE by one amino acid.

1 / 3

2 / 3

3 / 3

Previous Next

CACNA1C Goat Polyclonal Antibody

TA305878

USD 375.00

In Stock

Goat Anti-CACNA1C Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5.

CD10 (MME) Rabbit Polyclonal Antibody

TA590055

USD 409.00

In Stock

Rabbit Polyclonal CD10 Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cytochrome b c1 complex subunit 9 (UQCR10) Rabbit Polyclonal Antibody

TA335305

USD 375.00

5 Days

Rabbit Polyclonal Anti-UCRC Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

1 / 2

2 / 2

Previous Next

IRE1 (ERN1) Goat Polyclonal Antibody

TA305857

USD 375.00

2 Weeks

Goat Anti-ERN1 / IRE1a Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-PNAHGKIKAMISD, from the internal region of the protein sequence according to NP_001424.3.

NDUFA4L2 Rabbit Polyclonal Antibody

TA315629

USD 345.00

In Stock

Rabbit polyclonal anti-NDUFA4L2 antibody

Applications	WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2.

ADAM10 Rabbit Polyclonal Antibody

TA323232

USD 345.00

4 Weeks

Anti-ADAM10 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 209 amino acids of human ADAM metallopeptidase domain 10

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

CD10 (MME) Mouse Monoclonal Antibody [Clone ID: OTI3D11]

TA504507

USD 379.00

In Stock

MME (CD10) mouse monoclonal antibody, clone OTI3D11 (formerly 3D11)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

CD10 (MME) Mouse Monoclonal Antibody [Clone ID: OTI3D11]

TA504507S

USD 159.00

2 Days

MME (CD10) mouse monoclonal antibody, clone OTI3D11 (formerly 3D11)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1C1]

TA506513

USD 379.00

In Stock

TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1C1]

TA506513S

USD 159.00

2 Days

TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

CD10 (MME) Mouse Monoclonal Antibody [Clone ID: UMAB235]

UM800127

USD 468.00

In Stock

MME/CD10 mouse monoclonal antibody, clone UMAB235

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 22

2 / 22

3 / 22

4 / 22

5 / 22

6 / 22

7 / 22

8 / 22

9 / 22

10 / 22

11 / 22

12 / 22

13 / 22

14 / 22

15 / 22

16 / 22

17 / 22

18 / 22

19 / 22

20 / 22

21 / 22

22 / 22

Previous Next

CD10 (MME) Mouse Monoclonal Antibody [Clone ID: UMAB236]

UM800128

USD 468.00

In Stock

MME/CD10 mouse monoclonal antibody, clone UMAB236

Applications	10k-ChIP, FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 21

2 / 21

3 / 21

4 / 21

5 / 21

6 / 21

7 / 21

8 / 21

9 / 21

10 / 21

11 / 21

12 / 21

13 / 21

14 / 21

15 / 21

16 / 21

17 / 21

18 / 21

19 / 21

20 / 21

21 / 21

Previous Next

CD10 (MME) Mouse Monoclonal Antibody [Clone ID: UMAB236]

UM870128

USD 180.00

In Stock

MME/CD10 mouse monoclonal antibody, clone UMAB236

Applications	10k-ChIP, FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 21

2 / 21

3 / 21

4 / 21

5 / 21

6 / 21

7 / 21

8 / 21

9 / 21

10 / 21

11 / 21

12 / 21

13 / 21

14 / 21

15 / 21

16 / 21

17 / 21

18 / 21

19 / 21

20 / 21

21 / 21

Previous Next

1 - 16 of 16 results