Antibodies

View as table Download

Rabbit Polyclonal JMJD2C Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human JMJD2C protein (within residues 450-600). [Swiss-Prot Q9H3R0]

KDM4C (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1030-1056 amino acids from the C-terminal region of human JMJD2C

Rabbit Polyclonal JMJD2c Antibody

Applications ELISA, WB
Reactivities Human
Immunogen The immunogen for anti-JMJD2c antibody: human JMJD2c (Jumonji Domain containing 2c), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the central part of the protein.

Rabbit Polyclonal Anti-JMJD2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-JMJD2C Antibody: synthetic peptide directed towards the middle region of human JMJD2C. Synthetic peptide located within the following region: CLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQR

Rabbit Polyclonal Anti-KDM4C Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KDM4C

KDM4C Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-570 of human KDM4C (NP_055876.2).
Modifications Unmodified