Rabbit Polyclonal TLR9 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TLR9 antibody was raised against a peptide corresponding to 15 amino acids near the center of human TLR9. |
Rabbit Polyclonal TLR9 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TLR9 antibody was raised against a peptide corresponding to 15 amino acids near the center of human TLR9. |
Rabbit Polyclonal TLR9 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TLR9 antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human TLR9. |
TLR9 (N-term) goat polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Hamster, Mouse |
Immunogen | Synthetic peptide LSLKYNNLTKVPRQLPPSLEY-C corresponding to amino acids 204-224 of the N-terminal domain of mouse TLR9 |
TLR9 (26-300) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 26 and 300 of Human CD289(TLR9) |
TLR9 (1050-1100) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Primate, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TLR9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TLR9 Antibody: synthetic peptide directed towards the N terminal of human TLR9. Synthetic peptide located within the following region: VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN |
TLR9 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TLR9 |
TLR9 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TLR9 |
TLR9 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human TLR9 (NP_059138.1). |
Modifications | Unmodified |