Antibodies

View as table Download

Rabbit anti-PDHA1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PDHA1

Rabbit Polyclonal Anti-PDHA1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDHA1 antibody: synthetic peptide directed towards the N terminal of human PDHA1. Synthetic peptide located within the following region: MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP

Rabbit polyclonal anti-IARS2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IARS2.

Rabbit polyclonal anti-PDHA1 antibody

Applications IHC, WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PDHA1.

Rabbit Polyclonal Anti-PDHA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDHA1 antibody: synthetic peptide directed towards the C terminal of human PDHA1.

Rabbit Polyclonal Anti-BCAT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BCAT1

Rabbit Polyclonal antibody to BCAT2 (branched chain aminotransferase 2, mitochondrial)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 332 of BCAT2 (Uniprot ID#O15382)

Rabbit Polyclonal antibody to LARS2 (leucyl-tRNA synthetase 2, mitochondrial)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 181 and 458 of LARS2 (Uniprot ID#Q15031)

Rabbit Polyclonal antibody to Pyruvate Dehydrogenase E1 alpha (pyruvate dehydrogenase (lipoamide) alpha 1)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 39 and 325 of (Uniprot ID#P08559)

Anti-PDHA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 30-390 amino acids of human pyruvate dehydrogenase (lipoamide) alpha 1

Rabbit Polyclonal Anti-IARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IARS antibody: synthetic peptide directed towards the N terminal of human IARS. Synthetic peptide located within the following region: SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG

Rabbit Polyclonal Anti-IARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IARS antibody: synthetic peptide directed towards the middle region of human IARS. Synthetic peptide located within the following region: YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD

Rabbit Polyclonal Anti-ITPK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITPK1 antibody: synthetic peptide directed towards the middle region of human ITPK1. Synthetic peptide located within the following region: NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI

Rabbit Polyclonal Anti-BCAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCAT1 antibody: synthetic peptide directed towards the N terminal of human BCAT1. Synthetic peptide located within the following region: MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG

Rabbit Polyclonal Anti-VARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS antibody: synthetic peptide directed towards the middle region of human VARS. Synthetic peptide located within the following region: AQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML

Rabbit Polyclonal Anti-VARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS antibody: synthetic peptide directed towards the middle region of human VARS. Synthetic peptide located within the following region: VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP

Rabbit Polyclonal Anti-VARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS2 antibody: synthetic peptide directed towards the middle region of human VARS2. Synthetic peptide located within the following region: LERRFSRVQEVVQVLRALRATYQLTKARPRVLLQSSEPGDQGLFEAFLEP

Rabbit Polyclonal Anti-BCAT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human BCAT2