Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Mouse Monoclonal anti-NFATc1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NFATC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human NFATC2 |
Rabbit Polyclonal VAV1 Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VAV1 |
Rabbit Polyclonal Anti-Ppp3cb Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit polyclonal Vav (Tyr174) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Vav around the phosphorylation site of tyrosine 174 (E-I-YP-E-D). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VAV1 (Tyr174) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VAV1 around the phosphorylation site of Tyrosine 174 |
| Modifications | Phospho-specific |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit polyclonal anti-Calcineurin A antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 267 of human Calcineurin A |
Goat Anti-NFATC2 / NFAT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QQFRTGLSSPDARYQ, from the internal region of the protein sequence according to NP_036472.2; NP_775114.1; NP_001129493.1. |
Anti-VAV1 (Phospho-Tyr174) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 174 (E-I-Y(p)-E-D) derived from Human Vav. |
| Modifications | Phospho-specific |
Anti-VAV1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa. 172~176 (E-I-Y-E-D) derived from Human Vav. |
Anti-NFATC2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2-15 amino acids of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 |
Anti-NFAT5 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 711-724 amino acids of Human nuclear factor of activated T-cells 5, tonicity-responsive |
Anti-NFATC1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a C terminal 300 amino acids of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1 |
Anti-NFATC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 730-743 amino acids of Human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 |
Anti-NFATC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 420-434 amino acids of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4 |
Anti-NFATC4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 420-434 amino acids of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4 |
Active filters
Category
- Antibodies
Reactivities
- Rat
Conjugates
- Unconjugated
Families
- Transcription Factors
Pathways
- Natural killer cell mediated cytotoxicity