Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

51 - 100 of 236 results

Page 2 of 5

(reset)

Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody

TA335227

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the middle region of human ALDH3A2. Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GAD67 (GAD1) Rabbit Polyclonal Antibody

TA336218

USD 375.00

5 Days

Rabbit Polyclonal Anti-GAD1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-GAD1 Antibody: synthetic peptide directed towards the N terminal of human GAD1. Synthetic peptide located within the following region: MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGF

ECHS1 Rabbit Polyclonal Antibody

TA338193

USD 375.00

5 Days

Rabbit Polyclonal Anti-ECHS1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ECHS1 antibody: synthetic peptide directed towards the N terminal of human ECHS1. Synthetic peptide located within the following region: IIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAI

ECHS1 Rabbit Polyclonal Antibody

TA338194

USD 310.00

5 Days

Rabbit Polyclonal Anti-ECHS1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ECHS1 antibody: synthetic peptide directed towards the middle region of human ECHS1. Synthetic peptide located within the following region: RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIA

ECHS1 Rabbit Polyclonal Antibody

TA338195

USD 310.00

5 Days

Rabbit Polyclonal Anti-ECHS1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ECHS1 antibody: synthetic peptide directed towards the C terminal of human ECHS1. Synthetic peptide located within the following region: KESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ

ABAT Rabbit Polyclonal Antibody

TA339936

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABAT Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ABAT antibody: synthetic peptide directed towards the middle region of human ABAT. Synthetic peptide located within the following region: YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT

ABAT Rabbit Polyclonal Antibody

TA339937

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABAT Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ABAT antibody: synthetic peptide directed towards the middle region of human ABAT. Synthetic peptide located within the following region: IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW

1 / 2

2 / 2

Previous Next

ALDH9A1 Rabbit Polyclonal Antibody

TA342665

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALDH9A1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ALDH9A1 antibody: synthetic peptide directed towards the C terminal of human ALDH9A1. Synthetic peptide located within the following region: MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC

1 / 3

2 / 3

3 / 3

Previous Next

CNDP1 Rabbit Polyclonal Antibody

TA343002

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNDP1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-CNDP1 antibody: synthetic peptide directed towards the C terminal of human CNDP1. Synthetic peptide located within the following region: GSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFA

ALDH2 Mouse Monoclonal Antibody [Clone ID: 8D4-D6-D11]

TA346880

USD 380.00

4 Weeks

Mouse Monoclonal ALDH2 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat, Monkey, Hamster
Conjugation	Unconjugated

Aldehyde dehydrogenase 10 (ALDH3A2) Mouse Monoclonal Antibody [Clone ID: 3F7-H9-E12]

TA346881

USD 380.00

4 Weeks

Mouse Monoclonal Aldehyde dehydrogenase 10 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

ALDH9A1 Goat Polyclonal Antibody

TA355099

USD 375.00

5 Days

Goat Anti-ALDH9A1, Biotinylated Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-QKEILDKFTEEVVKQ., from the internal region of the protein sequence according to NP_000687.3.

Spermine synthase (SMS) Capture Mouse Monoclonal Antibody [Clone ID: OTI2G8]

TA600119

USD 379.00

2 Weeks

SMS Capture mouse monoclonal antibody, Luminex validated, clone OTI2G8

Applications	LMNX
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Matched ELISA Pair	TA700119

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GAD67 (GAD1) Mouse Monoclonal Antibody [Clone ID: OTI3H2]

CF500328

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GAD1 mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)

Applications	IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

GAD67 (GAD1) Mouse Monoclonal Antibody [Clone ID: OTI3G9]

CF500329

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GAD1 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)

Applications	IF, IHC, IP, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

GAD67 (GAD1) Mouse Monoclonal Antibody [Clone ID: OTI5D8]

CF500330

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GAD1 mouse monoclonal antibody, clone OTI5D8 (formerly 5D8)

Applications	IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CNDP1 Mouse Monoclonal Antibody [Clone ID: OTI2F8]

CF500448

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ALDH2 Mouse Monoclonal Antibody [Clone ID: OTI4H2]

CF500615

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDH2 mouse monoclonal antibody, clone OTI4H2 (formerly 4H2)

Applications	FC, IF
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

HIBCH Mouse Monoclonal Antibody [Clone ID: OTI3B10]

CF501316

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HIBCH mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

HIBCH Mouse Monoclonal Antibody [Clone ID: OTI3H5]

CF501317

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HIBCH mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)

Applications	FC, IHC, WB
Reactivities	Human, Dog
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

HIBCH Mouse Monoclonal Antibody [Clone ID: OTI2A5]

CF501318

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HIBCH mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

HIBCH Mouse Monoclonal Antibody [Clone ID: OTI1C7]

CF501319

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HIBCH mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications	FC, IF, WB
Reactivities	Human, Rat, Dog
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

HIBCH Mouse Monoclonal Antibody [Clone ID: OTI3E7]

CF501320

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HIBCH mouse monoclonal antibody, clone OTI3E7 (formerly 3E7)

Applications	FC, IF, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

HIBCH Mouse Monoclonal Antibody [Clone ID: OTI4G1]

CF501330

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HIBCH mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

HIBCH Mouse Monoclonal Antibody [Clone ID: OTI3G1]

CF501331

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HIBCH mouse monoclonal antibody, clone OTI3G1 (formerly 3G1)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

HIBCH Mouse Monoclonal Antibody [Clone ID: OTI3F6]

CF501332

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HIBCH mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

HIBCH Mouse Monoclonal Antibody [Clone ID: OTI5C5]

CF501361

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HIBCH mouse monoclonal antibody, clone OTI5C5 (formerly 5C5)

Applications	FC, IF, WB
Reactivities	Human, Rat, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

HIBCH Mouse Monoclonal Antibody [Clone ID: OTI3D11]

CF501387

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HIBCH mouse monoclonal antibody, clone OTI3D11 (formerly 3D11)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CNDP1 Mouse Monoclonal Antibody [Clone ID: OTI2D2]

CF502093

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

• 

CNDP1 Mouse Monoclonal Antibody [Clone ID: OTI1A5]

CF502097

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications	IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI2G8]

CF503091

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI 1A7]

CF503095

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI 1A7 (formerly 1A7)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI5C12]

CF503096

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI3A8]

CF503097

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI5F2]

CF503098

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5F2 (formerly 5F2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI3C9]

CF503099

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI5E5]

CF503100

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5E5 (formerly 5E5)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI2H1]

CF503101

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI1G7]

CF503102

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI 5F9]

CF503112

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI 5F9 (formerly 5F9)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Aldehyde dehydrogenase 10 (ALDH3A2) Mouse Monoclonal Antibody [Clone ID: OTI1H10]

CF503143

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications	WB
Reactivities	Human, Monkey, Rat
Conjugation	Unconjugated

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

Aldehyde dehydrogenase 10 (ALDH3A2) Mouse Monoclonal Antibody [Clone ID: OTI1D1]

CF503165

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications	WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 
• 

1 / 2

2 / 2

Previous Next

Aldehyde dehydrogenase 10 (ALDH3A2) Mouse Monoclonal Antibody [Clone ID: OTI 1B11]

CF503196

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI 1B11 (formerly 1B11)

Applications	WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

Aldehyde dehydrogenase 10 (ALDH3A2) Mouse Monoclonal Antibody [Clone ID: OTI1H4]

CF503197

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications	WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 
• 

1 / 2

2 / 2

Previous Next

Aldehyde dehydrogenase 10 (ALDH3A2) Mouse Monoclonal Antibody [Clone ID: OTI2A7]

CF503256

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications	FC, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Aldehyde dehydrogenase 10 (ALDH3A2) Mouse Monoclonal Antibody [Clone ID: OTI2D3]

CF503269

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)

Applications	WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

EHHADH Mouse Monoclonal Antibody [Clone ID: OTI2C4]

CF803072

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EHHADH mouse monoclonal antibody, clone OTI2C4

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ABAT Mouse Monoclonal Antibody [Clone ID: OTI3D2]

CF806896

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

ABAT Mouse Monoclonal Antibody [Clone ID: OTI6H1]

CF806898

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI6H1 (formerly 6H1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

ABAT Mouse Monoclonal Antibody [Clone ID: OTI7C4]

CF806964

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI7C4 (formerly 7C4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

51 - 100 of 236 results

Page 2 of 5