Rabbit polyclonal anti-ATF3 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATF3. |
Rabbit polyclonal anti-ATF3 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATF3. |
Rabbit Monoclonal antibody against ATF-3 (ATF3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-ATF3 Polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ATF3 |
Rabbit Polyclonal ATF3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Mammalian |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a region of human ATF3 (within residues 100-150). [UniProt# P18847] |
Rabbit polyclonal anti-ATF3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This antibody was produced from a synthetic peptide corresponding to aa 113-130 of human ATF3. |
Rabbit Polyclonal anti-Atf3 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Atf3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Atf3. Synthetic peptide located within the following region: ESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFI |
Rabbit Polyclonal Anti-ATF3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATF3 antibody: synthetic peptide directed towards the middle region of human ATF3. Synthetic peptide located within the following region: PLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK |
Carrier-free (BSA/glycerol-free) ATF3 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ATF3 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ATF3 |
ATF3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ATF3 |
ATF3 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human ATF3 (NP_001665.1). |
Modifications | Unmodified |
ATF3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human ATF3 (NP_001665.1). |
Modifications | Unmodified |
ATF3 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ATF3 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".