Rabbit anti-NR0B1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NR0B1 |
Rabbit anti-NR0B1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NR0B1 |
Rabbit Polyclonal antibody to NR0B1 (nuclear receptor subfamily 0, group B, member 1)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 96 and 406 of NR0B1 (Uniprot ID#P51843) |
Rabbit Polyclonal Anti-NR0B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the N terminal of human NR0B1. Synthetic peptide located within the following region: MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVG |
Rabbit Polyclonal Anti-NR0B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the middle region of human NR0B1. Synthetic peptide located within the following region: FCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKS |
Rabbit Polyclonal Antibody against NR0B1 (N-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This DAX1 (NR0B1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 4-34 amino acids from the N-terminal region of human DAX1 (NR0B1). |
Rabbit Polyclonal anti-NR0B1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the middle region of human NR0B1. Synthetic peptide located within the following region: QAIKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQ |
Rabbit Polyclonal Anti-NR0B1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the N terminal of human NR0B1. Synthetic peptide located within the following region: TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC |
Rabbit Polyclonal Antibody against NR0B1 (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This DAX1 (NR0B1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 304-333 amino acids from the C-terminal region of human DAX1 (NR0B1). |
Goat Polyclonal Antibody against NR0B1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CGEDHPQQGSTLY, from the internal region of the protein sequence according to NP_000466.2. |
Rabbit Polyclonal Anti-Nr0b1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Nr0b1 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Nr0b1. Synthetic peptide located within the following region: YIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFINSDVVTELF |
Carrier-free (BSA/glycerol-free) NR0B1 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NR0B1 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NR0B1 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |