Antibodies

View as table Download

NRG1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NRG1

NRG1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NRG1

Rabbit polyclonal NRG1 isoform-10 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human NRG1 isoform-10.

NRG1 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NRG1

Rabbit Polyclonal Anti-NRG1 isoform-10 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NRG1 isoform-10 Antibody: A synthesized peptide derived from human NRG1 isoform-10

Anti-Human Heregulinβ-1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Heregulinβ-1

Biotinylated Anti-Human Heregulinβ-1 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Heregulinβ-1

Rabbit Polyclonal Anti-NRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the N terminal of human NRG1. Synthetic peptide located within the following region: YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS

Rabbit Polyclonal Anti-NRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the middle region of human NRG1. Synthetic peptide located within the following region: SEVQVTVQGDKAVVSFEPSAAPTPKNRIFAFSFLPSTAPSFPSPTRNPEV

Carrier-free (BSA/glycerol-free) NRG1 mouse monoclonal antibody,clone OTI2C3

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NRG1 mouse monoclonal antibody,clone OTI3B6

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-NRG1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human NRG1

Rabbit Polyclonal Anti-NRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NRG1

NRG1 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NRG1

NRG1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NRG1

NRG1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NRG1

NRG1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NRG1

NRG1 mouse monoclonal antibody,clone OTI2C3

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

NRG1 mouse monoclonal antibody,clone OTI2C3

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

NRG1 mouse monoclonal antibody,clone OTI3B6

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

NRG1 mouse monoclonal antibody,clone OTI3B6

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated