Antibodies

Jump to Filters
View as table Download
GIPC (GIPC1) Rabbit Polyclonal Antibody
TA345929

USD 475.00

5 Days

Rabbit Polyclonal Anti-GIPC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GIPC1 antibody: synthetic peptide directed towards the N terminal of human GIPC1. Synthetic peptide located within the following region: SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA
GIPC (GIPC1) Rabbit Polyclonal Antibody
TA308356

USD 415.00

5 Days

Rabbit Polyclonal antibody to GIPC1 (GIPC PDZ domain containing family, member 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 273 and 333 of GIPC1
GIPC (GIPC1) (N-term) Rabbit Polyclonal Antibody
AP51843PU-N

USD 450.00

2 Weeks

GIPC (GIPC1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 51-81 amino acids from the N-terminal region of human GIPC1
GIPC (GIPC1) Goat Polyclonal Antibody
TA302499

USD 375.00

5 Days

Goat Polyclonal Antibody against GIPC1 / NIP

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GAIGDAKVGRY, from the C Terminus of the protein sequence according to NP_005707.1; NP_974197.1; NP_974199.1; NP_974196.1; NP_974198.1; NP_974223.1.
GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI4C11]
CF811914

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GIPC1 mouse monoclonal antibody,clone OTI4C11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI5C10]
CF811961

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GIPC1 mouse monoclonal antibody,clone OTI5C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI6A6]
CF811963

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GIPC1 mouse monoclonal antibody,clone OTI6A6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI4C11]
TA811914

USD 379.00

In Stock

GIPC1 mouse monoclonal antibody,clone OTI4C11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI4C11]
TA811914S

USD 159.00

2 Days

GIPC1 mouse monoclonal antibody,clone OTI4C11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI5C10]
TA811961

USD 379.00

In Stock

GIPC1 mouse monoclonal antibody,clone OTI5C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI5C10]
TA811961S

USD 159.00

2 Days

GIPC1 mouse monoclonal antibody,clone OTI5C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI6A6]
TA811963

USD 379.00

In Stock

GIPC1 mouse monoclonal antibody,clone OTI6A6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI6A6]
TA811963S

USD 159.00

2 Days

GIPC1 mouse monoclonal antibody,clone OTI6A6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated