Antibodies

View as table Download

Rabbit Polyclonal Anti-IREB2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-IREB2 antibody: synthetic peptide directed towards the middle region of human IREB2. Synthetic peptide located within the following region: IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK

IREB2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 201-230 amino acids from the Central region of human IREB2

Goat Anti-IREB2 / IRP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SIHYEGSEYKLSHGS, from the internal region of the protein sequence according to NP_004127.1.

Rabbit Polyclonal IRP2 Antibody

Applications WB
Reactivities Human, Mouse, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the murine IRP2 protein sequence (between residues 100-200). UniProt Q811J3