IREB2 Rabbit Polyclonal Antibody

CAT#: TA345869

Rabbit Polyclonal Anti-IREB2 Antibody

Product Images

WB Suggested Anti-IREB2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Liver

• 

  Application: Western blotting; Species+tissue/cell type: Mouse liver extract; How many ug'sof tissue/cell lysate run on the gel: 1. 60 ug mouse liver extract2. 60 ug mouse liver extract3. 60 ug mouse liver extract; Primary antibody dilution: 1: 500; Secondary antibody: Anti-rabbit HRP; Secondary antibody dilution: 1: 3000

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IREB2 antibody: synthetic peptide directed towards the middle region of human IREB2. Synthetic peptide located within the following region: IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 105 kDa
• Gene Name: iron responsive element binding protein 2
• Database Link:
  NP_004127
  Entrez Gene 64602 MouseEntrez Gene 3658 Human
  UniProt ID P48200
• Background: IREB2 binds to iron-responsive elements (IRES), which are stem-loop structures found in the 5'-UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3' UTR of transferrin receptor mRNA. IREB2 binds to the IRE element in ferritin which results in the repression of its mRNA translation. Binding of the protein to the transferrin receptor mRNA inhibits the degradation of this otherwise rapidly degraded mRNA.
• Synonyms: ACO3; IRP2; IRP2AD
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome