Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal SNAI1 (Ser246) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human: Ser246, Mouse: Ser246 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SNAI1 around the phosphorylation site of serine 246 (T-F-SP-R-M). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against SNAI1 (N-term R8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SNAI1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human SNAI1. |
Rabbit anti-Snail Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human Snail |
Rabbit Polyclonal SNAI1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SNAI1 |
Rabbit polyclonal anti-SNAI1 (Ab-246) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human SNAI1 around the phosphorylation site of serine 246 (T-F-SP-R-M) |
Rabbit Polyclonal SNAI1 (Ser246) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SNAI1 around the phosphorylation site of Serine 246 |
| Modifications | Phospho-specific |
SNAIL (SNAI1) mouse monoclonal antibody, clone AT2D5, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
SNAIL (SNAI1) mouse monoclonal antibody, clone AT2D5, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-SNAI1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SNAI1 Antibody: synthetic peptide directed towards the N terminal of human SNAI1. Synthetic peptide located within the following region: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL |
Rabbit Polyclonal Anti-SNAI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SNAI1 Antibody is: synthetic peptide directed towards the N-terminal region of Human SNAI1. Synthetic peptide located within the following region: RKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLP |
Mouse monoclonal Anti-SNAIL1 Clone 20C8
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SNAI1 mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
SNAI1 mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SNAI1 mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |