Rabbit polyclonal GR (Ab-211) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W). |
Rabbit polyclonal GR (Ab-226) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 226/234/246 (L-L-S-P-L). |
Rabbit polyclonal GR (Ser226) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human GR around the phosphorylation site of serine 226 (L-L-SP-P-L). |
| Modifications | Phospho-specific |
Rabbit anti-THRB Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human THRB |
Rabbit Polyclonal Anti-THR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THR1 Antibody: A synthesized peptide derived from human THR1 |
Rabbit polyclonal GR (Ab-203) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 203 (S-G-SP-P-G). |
Rabbit polyclonal GR (Ser203) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human GR around the phosphorylation site of serine 203 (S-G-SP-P-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal NR3C1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This NR3C1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-262 amino acids from the Central region of human NR3C1. |
Rabbit Polyclonal GR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GR |
Rabbit Polyclonal GR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GR |
Rabbit Polyclonal GR Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GR |
Rabbit Polyclonal GR (Ser203) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GR around the phosphorylation site of Serine 203 |
| Modifications | Phospho-specific |
Rabbit Polyclonal GR (Ser211) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GR around the phosphorylation site of Serine 211 |
| Modifications | Phospho-specific |
Rabbit Polyclonal GR (Ser226) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GR around the phosphorylation site of Serine 226 |
| Modifications | Phospho-specific |
Rabbit polyclonal Thyroid Hormone Receptor Beta antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Thyroid Hormone Receptor β antibody. |
| Modifications | Phospho-specific |
Rabbit polyclonal GR (Ser211) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-SP-P-W). |
| Modifications | Phospho-specific |
Rabbit polyclonal Thyroid Hormone Receptor beta 1 antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Anti-TR β1 antibody is affinity purified from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminal of human THRB isoform 1 protein. |
Rabbit Polyclonal Anti-Thrb Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Thrb antibody: synthetic peptide directed towards the N terminal of mouse Thrb. Synthetic peptide located within the following region: KSKDSDLDMALSQSSQPAHLPEEKPFPQVQSPPHSQKKGYIPSYLDKDEL |
Goat Polyclonal Antibody against THRB
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-REELQKSIGHKP, from the internal region of the protein sequence according to NP_000452.2. |
Rabbit polyclonal TR-β1 (Ser142) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TR-β1 around the phosphorylation site of serine 142 (H-P-SP-Y-S). |
| Modifications | Phospho-specific |
Rabbit Polyclonal GR (Ser211) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human GR around the phosphorylation site of Sersine 211 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-THRA Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human THRA |
Germany
Japan
United Kingdom
China
