Antibodies

View as table Download

Rabbit Polyclonal Anti-BHLHB3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHLHB3 Antibody: A synthesized peptide derived from human BHLHB3

SHARP1 (BHLHE41) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide around Lys31 of Human BHLHE41 / BHLHB3

Rabbit Polyclonal DEC2/SHARP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human PAI1/Serpine 1 protein (between residues 1-75) [UniProt Q9C0J9]

Rabbit Polyclonal Anti-BHLHB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-BHLHB3 Antibody: synthetic peptide directed towards the middle region of human BHLHB3. Synthetic peptide located within the following region: YCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTI

Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI10B11 (formerly 10B11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI11B5 (formerly 11B5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI11F6 (formerly 11F6)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI3H4 (formerly 3H4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI4E1 (formerly 4E1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI3A6 (formerly 3A6)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI8H5 (formerly 8H5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI8H2 (formerly 8H2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI8A8 (formerly 8A8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

BHLHE41 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)

Applications WB
Reactivities Human
Conjugation Unconjugated

BHLHE41 mouse monoclonal antibody, clone OTI10B11 (formerly 10B11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

BHLHE41 mouse monoclonal antibody, clone OTI11B5 (formerly 11B5)

Applications WB
Reactivities Human
Conjugation Unconjugated

BHLHE41 mouse monoclonal antibody, clone OTI11F6 (formerly 11F6)

Applications WB
Reactivities Human
Conjugation Unconjugated

BHLHE41 mouse monoclonal antibody, clone OTI3H4 (formerly 3H4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

BHLHE41 mouse monoclonal antibody, clone OTI4E1 (formerly 4E1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

BHLHE41 mouse monoclonal antibody, clone OTI4E1 (formerly 4E1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

BHLHE41 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

BHLHE41 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

BHLHE41 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

BHLHE41 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

BHLHE41 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

BHLHE41 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated