Rabbit Polyclonal Anti-BHLHB3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BHLHB3 Antibody: A synthesized peptide derived from human BHLHB3 |
Rabbit Polyclonal Anti-BHLHB3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BHLHB3 Antibody: A synthesized peptide derived from human BHLHB3 |
SHARP1 (BHLHE41) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide around Lys31 of Human BHLHE41 / BHLHB3 |
Rabbit Polyclonal DEC2/SHARP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human PAI1/Serpine 1 protein (between residues 1-75) [UniProt Q9C0J9] |
Rabbit Polyclonal Anti-BHLHB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-BHLHB3 Antibody: synthetic peptide directed towards the middle region of human BHLHB3. Synthetic peptide located within the following region: YCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTI |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI10B11 (formerly 10B11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI11B5 (formerly 11B5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI11F6 (formerly 11F6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI3H4 (formerly 3H4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI4E1 (formerly 4E1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI3A6 (formerly 3A6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI8H5 (formerly 8H5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI8H2 (formerly 8H2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI8A8 (formerly 8A8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BHLHE41 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
BHLHE41 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
BHLHE41 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
BHLHE41 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
BHLHE41 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
BHLHE41 mouse monoclonal antibody, clone OTI10B11 (formerly 10B11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
BHLHE41 mouse monoclonal antibody, clone OTI10B11 (formerly 10B11), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
BHLHE41 mouse monoclonal antibody, clone OTI10B11 (formerly 10B11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
BHLHE41 mouse monoclonal antibody, clone OTI10B11 (formerly 10B11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
BHLHE41 mouse monoclonal antibody, clone OTI11B5 (formerly 11B5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
BHLHE41 mouse monoclonal antibody, clone OTI11B5 (formerly 11B5), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
BHLHE41 mouse monoclonal antibody, clone OTI11B5 (formerly 11B5), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
BHLHE41 mouse monoclonal antibody, clone OTI11B5 (formerly 11B5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
BHLHE41 mouse monoclonal antibody, clone OTI11F6 (formerly 11F6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
BHLHE41 mouse monoclonal antibody, clone OTI11F6 (formerly 11F6), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
BHLHE41 mouse monoclonal antibody, clone OTI11F6 (formerly 11F6), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
BHLHE41 mouse monoclonal antibody, clone OTI11F6 (formerly 11F6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
BHLHE41 mouse monoclonal antibody, clone OTI3H4 (formerly 3H4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
BHLHE41 mouse monoclonal antibody, clone OTI3H4 (formerly 3H4), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
BHLHE41 mouse monoclonal antibody, clone OTI3H4 (formerly 3H4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
BHLHE41 mouse monoclonal antibody, clone OTI3H4 (formerly 3H4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
BHLHE41 mouse monoclonal antibody, clone OTI4E1 (formerly 4E1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
BHLHE41 mouse monoclonal antibody, clone OTI4E1 (formerly 4E1), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
BHLHE41 mouse monoclonal antibody, clone OTI4E1 (formerly 4E1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
BHLHE41 mouse monoclonal antibody, clone OTI4E1 (formerly 4E1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
BHLHE41 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
BHLHE41 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
BHLHE41 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
BHLHE41 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
BHLHE41 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
BHLHE41 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
BHLHE41 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
BHLHE41 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |